Recombinant Cricetulus griseus Glutamine synthetase (GLUL)

Produktübersicht

• Artikelname: Recombinant Cricetulus griseus Glutamine synthetase (GLUL)
• Artikelnummer: CSB-EP009553DXUA0
• Hersteller Artikelnummer: CSB-EP009553DXUa0
• Alternativnummer: CSB-EP009553DXUA0-1, CSB-EP009553DXUA0-100, CSB-EP009553DXUA0-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (GS)(Glutamate--ammonia ligase)(Palmitoyltransferase GLUL)

Produkteigenschaften

• Molekulargewicht: 46.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: P04773
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 2-373aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSESSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIMEAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEGIRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGNWNGAGCHTNF