Recombinant Human PCNA-associated factor (PCLAF)

Artikelnummer: CSB-EP012164HU
Artikelname: Recombinant Human PCNA-associated factor (PCLAF)
Artikelnummer: CSB-EP012164HU
Hersteller Artikelnummer: CSB-EP012164HU
Alternativnummer: CSB-EP012164HU-1, CSB-EP012164HU-100, CSB-EP012164HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Hepatitis C virus NS5A-transactivated protein 9 ,HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ,OEATC-1,PCNA-associated factor of 15KDA ,PAF15 ,p15PAF
Molekulargewicht: 39 kDa
Tag: N-terminal GST-tagged
UniProt: Q15004
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-111aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.