Recombinant Human PCNA-associated factor (PCLAF)
Artikelnummer:
CSB-EP012164HU
- Bilder (0)
| Artikelname: | Recombinant Human PCNA-associated factor (PCLAF) |
| Artikelnummer: | CSB-EP012164HU |
| Hersteller Artikelnummer: | CSB-EP012164HU |
| Alternativnummer: | CSB-EP012164HU-1, CSB-EP012164HU-100, CSB-EP012164HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Hepatitis C virus NS5A-transactivated protein 9 ,HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ,OEATC-1,PCNA-associated factor of 15KDA ,PAF15 ,p15PAF |
| Molekulargewicht: | 39 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | Q15004 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1-111aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE |
Produktgarantie und fachkundiger Support
