Recombinant Escherichia coli Translation initiation factor IF-2 (infB), partial

Artikelnummer: CSB-EP015164ENV
Artikelname: Recombinant Escherichia coli Translation initiation factor IF-2 (infB), partial
Artikelnummer: CSB-EP015164ENV
Hersteller Artikelnummer: CSB-EP015164ENV
Alternativnummer: CSB-EP015164ENV-1, CSB-EP015164ENV-100, CSB-EP015164ENV-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 61.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P0A705
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.134.
Quelle: E.coli
Expression System: 382-890aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRSTKVASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAQVPVVVAVNKIDKPEADPDRVKNELSQYGILPEEWGGESQFVHVSAKAGTGIDELLDAILLQAEVLELKAVRKGMASGAVIESFLDKGRGPVATVLVREGTLHKGDIVLCGFEYGRVRAMRNELGQEVLEAGPSIPVEILGLSGVPA
Anwendungsbeschreibung: Research Areas: Others