Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5), partial
Artikelnummer:
CSB-EP015652HU
- Bilder (0)
| Artikelname: | Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5), partial |
| Artikelnummer: | CSB-EP015652HU |
| Hersteller Artikelnummer: | CSB-EP015652HU |
| Alternativnummer: | CSB-EP015652HU-1, CSB-EP015652HU-100, CSB-EP015652HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Complex I-SGDH ,CI-SGDHNADH-ubiquinone oxidoreductase SGDH subunit |
| Molekulargewicht: | 27.5 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | O43674 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 94-189aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
Produktgarantie und fachkundiger Support
