Recombinant Human Neural retina-specific leucine zipper protein (NRL)

Artikelnummer: CSB-EP016086HU
Artikelname: Recombinant Human Neural retina-specific leucine zipper protein (NRL)
Artikelnummer: CSB-EP016086HU
Hersteller Artikelnummer: CSB-EP016086HU
Alternativnummer: CSB-EP016086HU-1, CSB-EP016086HU-100, CSB-EP016086HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: NRL (D14S46E)
Molekulargewicht: 33.4 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P54845
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-237aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL