Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl)

Artikelnummer: CSB-EP016086MO
Artikelname: Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl)
Artikelnummer: CSB-EP016086MO
Hersteller Artikelnummer: CSB-EP016086MO
Alternativnummer: CSB-EP016086MO-1, CSB-EP016086MO-100, CSB-EP016086MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Nrl, Neural retina-specific leucine zipper protein, NRL
Molekulargewicht: 46.1 kDa
Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
UniProt: P54846
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-237aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.