Recombinant Human Origin recognition complex subunit 4 (ORC4)

Produktübersicht

• Artikelname: Recombinant Human Origin recognition complex subunit 4 (ORC4)
• Artikelnummer: CSB-EP017234HU
• Hersteller Artikelnummer: CSB-EP017234HU
• Alternativnummer: CSB-EP017234HU-1, CSB-EP017234HU-100, CSB-EP017234HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Origin recognition complex, subunit 4, S. cerevisiae, homolog of, FLJ46668, HSORC4, ORC 4, ORC 4L, ORC 4P, ORC4, ORC4_HUMAN, ORC4L, ORC4L protein, ORC4P, Origin recognition complex subunit 4 (yeast homolog) like, Origin recognition complex subunit 4, Origin recognition complex subunit 4 like (yeast), Origin recognition complex subunit 4 like, origin recognition complex, subunit 4 homolog, Origin recognition complex, subunit 4, S. cerevisiae, homolog-like

Produkteigenschaften

• Molekulargewicht: 66.4 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: O43929
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-436aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQY

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.