Recombinant Mouse Pituitary homeobox 1 (Pitx1)

Produktübersicht

• Artikelname: Recombinant Mouse Pituitary homeobox 1 (Pitx1)
• Artikelnummer: CSB-EP018042MO
• Hersteller Artikelnummer: CSB-EP018042MO
• Alternativnummer: CSB-EP018042MO-1, CSB-EP018042MO-100, CSB-EP018042MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Hindlimb-expressed homeobox protein backfoot,Homeobox protein P-OTX,Homeobox protein PITX1,Paired-like homeodomain transcription factor 1,Pituitary OTX-related factor

Produkteigenschaften

• Molekulargewicht: 40.9 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P70314
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-315aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLN

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.