Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5)
Artikelnummer:
CSB-EP018103MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5) |
| Artikelnummer: | CSB-EP018103MO |
| Hersteller Artikelnummer: | CSB-EP018103MO |
| Alternativnummer: | CSB-EP018103MO-1, CSB-EP018103MO-100, CSB-EP018103MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Group V phospholipase A2,PLA2-10Phosphatidylcholine 2-acylhydrolase 5 |
| Molekulargewicht: | 29.8 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P97391 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 21-137aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC |
Produktgarantie und fachkundiger Support
