Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp), partial

Artikelnummer: CSB-EP018202OEI
Artikelname: Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp), partial
Artikelnummer: CSB-EP018202OEI
Hersteller Artikelnummer: CSB-EP018202OEI
Alternativnummer: CSB-EP018202OEI-1, CSB-EP018202OEI-100, CSB-EP018202OEI-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: DM20Lipophilin
Molekulargewicht: 11.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P79826
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 150-218aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD