Recombinant Human Perforin-1 (PRF1)

Artikelnummer: CSB-EP018668HU
Artikelname: Recombinant Human Perforin-1 (PRF1)
Artikelnummer: CSB-EP018668HU
Hersteller Artikelnummer: CSB-EP018668HU
Alternativnummer: CSB-EP018668HU-1, CSB-EP018668HU-100, CSB-EP018668HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Cytolysin,Lymphocyte pore-forming protein ,PFP
Molekulargewicht: 75.2 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P14222
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 22-555aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFPVDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARDAARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.