Recombinant Human Ribonuclease inhibitor (RNH1)

Artikelnummer: CSB-EP019901HU
Artikelname: Recombinant Human Ribonuclease inhibitor (RNH1)
Artikelnummer: CSB-EP019901HU
Hersteller Artikelnummer: CSB-EP019901HU
Alternativnummer: CSB-EP019901HU-1, CSB-EP019901HU-100, CSB-EP019901HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Ribonuclease inhibitor(Placental ribonuclease inhibitor)(Placental RNase inhibitor)(Ribonuclease/angiogenin inhibitor 1)(RAI)
Molekulargewicht: 53.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P13489
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 2-461aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSS