Recombinant Human Ribonuclease inhibitor (RNH1)

Artikelnummer: CSB-EP019901HUB1
Artikelname: Recombinant Human Ribonuclease inhibitor (RNH1)
Artikelnummer: CSB-EP019901HUB1
Hersteller Artikelnummer: CSB-EP019901HUb1
Alternativnummer: CSB-EP019901HUB1-1, CSB-EP019901HUB1-100, CSB-EP019901HUB1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Placental ribonuclease inhibitor,Placental RNase inhibitor,Ribonuclease/angiogenin inhibitor 1,RAI
Molekulargewicht: 57.3 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P13489
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 2-461aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.