Recombinant Human Osteopontin (SPP1), partial

Artikelnummer: CSB-EP022603HU1
Artikelname: Recombinant Human Osteopontin (SPP1), partial
Artikelnummer: CSB-EP022603HU1
Hersteller Artikelnummer: CSB-EP022603HU1
Alternativnummer: CSB-EP022603HU1-1, CSB-EP022603HU1-100, CSB-EP022603HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Bone sialoprotein 1,Nephropontin,Secreted phosphoprotein 1,Urinary stone protein,Uropontin
Molekulargewicht: 23.8 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P10451
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.80.
Quelle: E.coli
Expression System: 17-168aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLR
Anwendungsbeschreibung: Research Areas: Cancer