Recombinant Human Osteopontin (SPP1), partial

Artikelnummer: CSB-EP022603HU2
Artikelname: Recombinant Human Osteopontin (SPP1), partial
Artikelnummer: CSB-EP022603HU2
Hersteller Artikelnummer: CSB-EP022603HU2
Alternativnummer: CSB-EP022603HU2-1, CSB-EP022603HU2-100, CSB-EP022603HU2-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Bone sialoprotein 1,Nephropontin,Secreted phosphoprotein 1,Urinary stone protein,Uropontin
Molekulargewicht: 22.8 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P10451
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.81.
Quelle: E.coli
Expression System: 17-167aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGL
Anwendungsbeschreibung: Research Areas: Cancer