Recombinant Human Sterol regulatory element-binding protein 1 (SREBF1), partial, Biotinylated

Artikelnummer: CSB-EP022657HU1-B
Artikelname: Recombinant Human Sterol regulatory element-binding protein 1 (SREBF1), partial, Biotinylated
Artikelnummer: CSB-EP022657HU1-B
Hersteller Artikelnummer: CSB-EP022657HU1-B
Alternativnummer: CSB-EP022657HU1-B-1, CSB-EP022657HU1-B-100, CSB-EP022657HU1-B-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Class D basic helix-loop-helix protein 1,Sterol regulatory element-binding transcription factor 1
Molekulargewicht: 98.0 kDa
Tag: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
UniProt: P36956
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.111.
Quelle: E.coli
Expression System: 1-487aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAM
Anwendungsbeschreibung: Research Areas: Epigenetics and Nuclear Signaling