Recombinant Human Transcription factor E2-alpha (TCF3), partial

Artikelnummer: CSB-EP023301HU(F2)
Artikelname: Recombinant Human Transcription factor E2-alpha (TCF3), partial
Artikelnummer: CSB-EP023301HU(F2)
Hersteller Artikelnummer: CSB-EP023301HU(F2)
Alternativnummer: CSB-EP023301HU(F2)-1, CSB-EP023301HU(F2)-100, CSB-EP023301HU(F2)-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Class B basic helix-loop-helix protein 21,Immunoglobulin enhancer-binding factor E12/E47,Immunoglobulin transcription factor 1,Kappa-E2-binding factor,Transcription factor 3,Transcription factor ITF-1
Molekulargewicht: 16.3 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P15923
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.236.
Quelle: E.coli
Expression System: 535-613aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAA
Anwendungsbeschreibung: Research Areas: Immunology