Recombinant Bovine Ubiquitin-conjugating enzyme E2 variant 1(UBE2V1),Escherichia Coli Preis auf Anfrage

Artikelnummer: CSB-EP025482BO
Artikelname: Recombinant Bovine Ubiquitin-conjugating enzyme E2 variant 1(UBE2V1),Escherichia Coli Preis auf Anfrage
Artikelnummer: CSB-EP025482BO
Hersteller Artikelnummer: CSB-EP025482BO
Alternativnummer: CSB-EP025482BO-1, CSB-EP025482BO-100, CSB-EP025482BO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Alternative Synonym: Recommended name: Ubiquitin-conjugating enzyme E2 variant 1 Short name= UEV-1
Tag: The tag type will be determined during production process.
UniProt: Q3SZ52
Puffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Quelle: E.coli
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYE NRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVL QELRRLMMSKENMKLPQPPEGQCYSN
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.