Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Artikelnummer: CSB-EP322925LCP1
Artikelname: Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial
Artikelnummer: CSB-EP322925LCP1
Hersteller Artikelnummer: CSB-EP322925LCP1
Alternativnummer: CSB-EP322925LCP1-1, CSB-EP322925LCP1-100, CSB-EP322925LCP1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Pre-GP-C (GP-C)
Molekulargewicht: 27.7 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P17332
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 59-258aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LIYKGTYELQTLELNMETLNMTMPLSCTKNNSHHYIRVGNETGLELTLTNTSILNHKFCNLSDAHKRNLYDHSLMSIISTFHLSIPNFNQYEAMSCDFNGGKITVQYNLSHSFAVDAAGHCGTLANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWDDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.