Recombinant Mouse Putative ATP-dependent RNA helicase Pl10 (D1Pas1)

Artikelnummer: CSB-EP325821MO
Artikelname: Recombinant Mouse Putative ATP-dependent RNA helicase Pl10 (D1Pas1)
Artikelnummer: CSB-EP325821MO
Hersteller Artikelnummer: CSB-EP325821MO
Alternativnummer: CSB-EP325821MO-1,CSB-EP325821MO-100,CSB-EP325821MO-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Alternative Synonym: Recommended name: Putative ATP-dependent RNA helicase Pl10 EC= 3.6.4.13
Molekulargewicht: 79.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P16381
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 2-660aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SHVAEEDELGLDQQLAGLDLTSRDSQSGGSTASKGRYIPPHLRNREAAKAFYDKDGSRWSKDKDAYSSFGSRSDTRAKSSFFSDRGGSGSRGRFDERGRSDYESVGSRGGRSGFGKFERGGNSRWCDKADEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKEN
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.