Recombinant Influenza A virus Nucleoprotein (NP)

Produktübersicht

• Artikelname: Recombinant Influenza A virus Nucleoprotein (NP)
• Artikelnummer: CSB-EP325878IMI
• Hersteller Artikelnummer: CSB-EP325878IMI
• Alternativnummer: CSB-EP325878IMI-1, CSB-EP325878IMI-100, CSB-EP325878IMI-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nucleocapsid protein ,Protein N

Produkteigenschaften

• Molekulargewicht: 72.2 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P16980
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-498aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASQGTKRPYEQMETGGERQNATEIRASVGKMVGGIGRFYIQMCTELKLNDYEGRLIQNSITIEKMVLSAFDERRNKYLEEHPNTGKDPKKTGGPIYRKREGKWIRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIED