Recombinant Escherichia coli Periplasmic oligopeptide-binding protein (oppA)

Produktübersicht

• Artikelname: Recombinant Escherichia coli Periplasmic oligopeptide-binding protein (oppA)
• Artikelnummer: CSB-EP326098ENV
• Hersteller Artikelnummer: CSB-EP326098ENV
• Alternativnummer: CSB-EP326098ENV-1, CSB-EP326098ENV-100, CSB-EP326098ENV-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: /

Produkteigenschaften

• Molekulargewicht: 65.8 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: P23843
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 27-543aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQK