Recombinant Canine coronavirus Nucleoprotein (N)

Produktübersicht

• Artikelname: Recombinant Canine coronavirus Nucleoprotein (N)
• Artikelnummer: CSB-EP327521CCOB1
• Hersteller Artikelnummer: CSB-EP327521CCOb1
• Alternativnummer: CSB-EP327521CCOB1-1, CSB-EP327521CCOB1-100, CSB-EP327521CCOB1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nucleocapsid protein,NC,Protein N

Produkteigenschaften

• Molekulargewicht: 50.9 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: P36298
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-381aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPITLEQGSKFWDLCPRDFVPKGIGNKDQQIGYWNRQTRYRMVKGRRKNLPEKWFFYYLGTGPHADAKFKQKLDGVVWVARGDSMTKPTTLGTRGTNNESKALKFDVKVPSEFHLEVNQLRDNSRSRSQSRSQSRNRSQSRGRQLSNNKKDDNVEQAVLAALKKLGVDTEKQQRSRSKSKERSSSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSS