Recombinant Human herpesvirus 6B Envelope glycoprotein B (gB), partial

Produktübersicht

• Artikelname: Recombinant Human herpesvirus 6B Envelope glycoprotein B (gB), partial
• Artikelnummer: CSB-EP327525HKAC7
• Hersteller Artikelnummer: CSB-EP327525HKAc7
• Alternativnummer: CSB-EP327525HKAC7-1, CSB-EP327525HKAC7-100, CSB-EP327525HKAC7-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: gB

Produkteigenschaften

• Molekulargewicht: 50.5 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P36320
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 20-399aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: IYCDSDDYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKNELTFPTSYRDVGVVYFLDRTVMGLAMPVYEANLVNSRAQCYSAVAIKRPDGTVFSAYHEDNNKNETLELFPLNFKSVTNKRFITTKEPYFARGPLWLYSTSTSLNCIVTEATAKAKYPFSYFALTTGEIVEGSPFFDGSNGKHFAEPLEKLTILENYTMIEDLMNGMNGATTLVRKIAFLEKG