Recombinant Human papillomavirus type 52 Protein E6 (E6)

Artikelnummer: CSB-EP334186HNY
Artikelname: Recombinant Human papillomavirus type 52 Protein E6 (E6)
Artikelnummer: CSB-EP334186HNY
Hersteller Artikelnummer: CSB-EP334186HNY
Alternativnummer: CSB-EP334186HNY-1, CSB-EP334186HNY-100, CSB-EP334186HNY-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: E6, Protein E6
Molekulargewicht: 33.9 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P36814
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-148aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MFEDPATRPRTLHELCEVLEESVHEIRLQCVQCKKELQRREVYKFLFTDLRIVYRDNNPYGVCIMCLRFLSKISEYRHYQYSLYGKTLEERVKKPLSEITIRCIICQTPLCPEEKERHVNANKRFHNIMGRWTGRCSECWRPRPVTQV
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.