Recombinant Human papillomavirus 30 Protein E7 (E7)

Artikelnummer: CSB-EP334189HNC
Artikelname: Recombinant Human papillomavirus 30 Protein E7 (E7)
Artikelnummer: CSB-EP334189HNC
Hersteller Artikelnummer: CSB-EP334189HNC
Alternativnummer: CSB-EP334189HNC-1,CSB-EP334189HNC-100,CSB-EP334189HNC-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: E7
Molekulargewicht: 18.9 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P36826
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-105aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MHGKVTTIPEYILDLVPQTEIDLHCYEQLNSSEEEDEDEVDNLQKQPQQARQEEQHPCYLINTQCCRCASAVQLAVQSPTKELRALQQMLMGALELVCPLCATRR
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.