Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)

Produktübersicht

• Artikelname: Recombinant Legionella pneumophila Peptidoglycan-associated lipoprotein (pal)
• Artikelnummer: CSB-EP340792LNYA2
• Hersteller Artikelnummer: CSB-EP340792LNYa2
• Alternativnummer: CSB-EP340792LNYA2-1, CSB-EP340792LNYA2-100, CSB-EP340792LNYA2-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: 19KDA surface antigen PPL

Produkteigenschaften

• Molekulargewicht: 32.8 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: P26493
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 22-176aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR