Recombinant Amaranthus caudatus Antimicrobial peptide 2

Produktübersicht

• Artikelname: Recombinant Amaranthus caudatus Antimicrobial peptide 2
• Artikelnummer: CSB-EP340863AIHE0
• Hersteller Artikelnummer: CSB-EP340863AIHe0
• Alternativnummer: CSB-EP340863AIHE0-1, CSB-EP340863AIHE0-100, CSB-EP340863AIHE0-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (AMP2)(AMP1)

Produkteigenschaften

• Molekulargewicht: 29.9 kDa
• Tag: N-terminal GST-tagged
• UniProt: P27275
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 26-55aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VGECVRGRCPSGMCCSQFGYCGKGPKYCGR