Recombinant Pantoea stewartii subsp. stewartii Transcriptional activator protein esaR (esaR)

Produktübersicht

• Artikelname: Recombinant Pantoea stewartii subsp. stewartii Transcriptional activator protein esaR (esaR)
• Artikelnummer: CSB-EP347483EGK
• Hersteller Artikelnummer: CSB-EP347483EGK
• Alternativnummer: CSB-EP347483EGK-1,CSB-EP347483EGK-100,CSB-EP347483EGK-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Recommended name: Transcriptional activator protein esaR

Produkteigenschaften

• Molekulargewicht: 35.0 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: P54293
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-249aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MFSFFLENQTITDTLQTYIQRKLSPLGSPDYAYTVVSKKNPSNVLIISSYPDEWIRLYRANNFQLTDPVILTAFKRTSPFAWDENITLMSDLRFTKIFSLSKQYNIVNGFTYVLHDHMNNLALLSVIIKGNDQTALEQRLAAEQGTMQMLLIDFNEQMYRLAGTEGERAPALNQSADKTIFSSRENEVLYWASMGKTYAEIAAITGISVSTVKFHIKNVVVKLGVSNARQAIRLGVELDLIRPAASAAR

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.