Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA)

Artikelnummer: CSB-EP351195ENV
Artikelname: Recombinant Escherichia coli 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA)
Artikelnummer: CSB-EP351195ENV
Hersteller Artikelnummer: CSB-EP351195ENV
Alternativnummer: CSB-EP351195ENV-1,CSB-EP351195ENV-100,CSB-EP351195ENV-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Alternative Synonym: BPG-dependent PGAM,PGAM,Phosphoglyceromutase,dPGM,EC 5.4.2.11
Molekulargewicht: 33.5 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: P62707
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 2-250aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.