Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA)

Artikelnummer: CSB-EP351810HU1
Artikelname: Recombinant Human Peptidyl-prolyl cis-trans isomerase A (PPIA)
Artikelnummer: CSB-EP351810HU1
Hersteller Artikelnummer: CSB-EP351810HU1
Alternativnummer: CSB-EP351810HU1-1, CSB-EP351810HU1-100, CSB-EP351810HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Cyclophilin ACyclosporin A-binding proteinRotamase A
Molekulargewicht: 44.9 kDa
Tag: N-terminal GST-tagged
UniProt: P62937
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 2-165aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.