Recombinant Simian retrovirus SRV-1 Gag polyprotein (gag), partial

Artikelnummer: CSB-EP361194SHM
Artikelname: Recombinant Simian retrovirus SRV-1 Gag polyprotein (gag), partial
Artikelnummer: CSB-EP361194SHM
Hersteller Artikelnummer: CSB-EP361194SHM
Alternativnummer: CSB-EP361194SHM-1,CSB-EP361194SHM-100,CSB-EP361194SHM-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Alternative Synonym: Core polyprotein
Molekulargewicht: 18.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P04022
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 2-100aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVM
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.