Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial
Artikelnummer:
CSB-EP617923HU
- Bilder (0)
| Artikelname: | Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial |
| Artikelnummer: | CSB-EP617923HU |
| Hersteller Artikelnummer: | CSB-EP617923HU |
| Alternativnummer: | CSB-EP617923HU-1, CSB-EP617923HU-100, CSB-EP617923HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Inter-alpha-trypsin inhibitor family heavy chain-related protein |
| Molekulargewicht: | 42.9 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | Q14624 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 689-930aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL |
Produktgarantie und fachkundiger Support
