Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)

Artikelnummer: CSB-EP673458HU
Artikelname: Recombinant Human BTB/POZ domain-containing protein KCTD21 (KCTD21)
Artikelnummer: CSB-EP673458HU
Hersteller Artikelnummer: CSB-EP673458HU
Alternativnummer: CSB-EP673458HU-1, CSB-EP673458HU-100, CSB-EP673458HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: KCASH2 protein,Potassium channel tetramerization domain-containing protein 21
Molekulargewicht: 36.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q4G0X4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.179.
Quelle: E.coli
Expression System: 1-260aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIR
Anwendungsbeschreibung: Research Areas: Cell Biology