Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1 (Ripk1)

Artikelnummer: CSB-EP720181MOA2
Artikelname: Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1 (Ripk1)
Artikelnummer: CSB-EP720181MOA2
Hersteller Artikelnummer: CSB-EP720181MOa2
Alternativnummer: CSB-EP720181MOA2-1, CSB-EP720181MOA2-100, CSB-EP720181MOA2-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Cell death protein RIP (Receptor-interacting protein 1) (RIP-1) (Rinp) (Rip)
Molekulargewicht: 87.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q60855
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-656aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNVEEILE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.