Recombinant Rat FAD-linked sulfhydryl oxidase ALR (Gfer)

Produktübersicht

• Artikelname: Recombinant Rat FAD-linked sulfhydryl oxidase ALR (Gfer)
• Artikelnummer: CSB-EP733907RA
• Hersteller Artikelnummer: CSB-EP733907RA
• Alternativnummer: CSB-EP733907RA-1, CSB-EP733907RA-100, CSB-EP733907RA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Augmenter of liver regeneration

Produkteigenschaften

• Molekulargewicht: 38.8 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: Q63042
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-198aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD