Recombinant Human Regenerating islet-derived protein 3-gamma (REG3G)

Produktübersicht

• Artikelname: Recombinant Human Regenerating islet-derived protein 3-gamma (REG3G)
• Artikelnummer: CSB-EP751009HU
• Hersteller Artikelnummer: CSB-EP751009HU
• Alternativnummer: CSB-EP751009HU-1, CSB-EP751009HU-100, CSB-EP751009HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (REG-3-gamma)(Pancreatitis-associated protein 1B)(PAP-1B)(Pancreatitis-associated protein IB)(PAP IB)(Regenerating islet-derived protein III-gamma)(REG III)(Reg III-gamma)

Produkteigenschaften

• Molekulargewicht: 44.0 kDa
• Tag: N-terminal GST-tagged
• UniProt: Q6UW15
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 27-175aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.