Recombinant Human Immunoglobulin-like domain-containing receptor 2 (ILDR2), partial

Produktübersicht

• Artikelname: Recombinant Human Immunoglobulin-like domain-containing receptor 2 (ILDR2), partial
• Artikelnummer: CSB-EP751251HU
• Hersteller Artikelnummer: CSB-EP751251HU
• Alternativnummer: CSB-EP751251HU-1, CSB-EP751251HU-100, CSB-EP751251HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ILDR2, C1orf32Immunoglobulin-like domain-containing receptor 2

Produkteigenschaften

• Molekulargewicht: 48.1 kDa
• Tag: N-terminal GST-tagged
• UniProt: Q71H61
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-186aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE