Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial

Artikelnummer: CSB-EP801781PI
Artikelname: Recombinant Pig T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial
Artikelnummer: CSB-EP801781PI
Hersteller Artikelnummer: CSB-EP801781PI
Alternativnummer: CSB-EP801781PI-1, CSB-EP801781PI-100, CSB-EP801781PI-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (CD antigen CD3e)
Molekulargewicht: 15.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q7YRN2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 22-116aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDL
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.