Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial

Artikelnummer: CSB-EP851556HU2
Artikelname: Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial
Artikelnummer: CSB-EP851556HU2
Hersteller Artikelnummer: CSB-EP851556HU2
Alternativnummer: CSB-EP851556HU2-1, CSB-EP851556HU2-100, CSB-EP851556HU2-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 74.3 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q8TE60
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.75.
Quelle: E.coli
Expression System: 48-650aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SDSSSGASGLNDDYVFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSSPAGHHPHVLYKRTAEEKIQRYRGYPGSGRNYPGYSPSHIPHASQSRETEYHHRRLQKQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLNVETLVVAD
Anwendungsbeschreibung: Research Areas: Cell Biology