Recombinant Human helicase MOV-10 (MOV10)

Produktübersicht

• Artikelname: Recombinant Human helicase MOV-10 (MOV10)
• Artikelnummer: CSB-EP862068HU(A4)
• Hersteller Artikelnummer: CSB-EP862068HU(A4)
• Alternativnummer: CSB-EP862068HU(A4)-1, CSB-EP862068HU(A4)-100, CSB-EP862068HU(A4)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Armitage homolog)(Moloney leukemia virus 10 protein)

Produkteigenschaften

• Molekulargewicht: 119.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9HCE1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-1003aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYGMKIANLAYVTKTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHGKHGVDVEVQGPHEARDGQLLIRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFYNEDQELPCPLGPGECYELHVHCKTSFVGYFPATVLWELLGPGESGSEGAGTFYIARFLAAVAHSPLAAQLKPMTP

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.