Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH)

Artikelnummer: CSB-EP864008HU
Artikelname: Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH)
Artikelnummer: CSB-EP864008HU
Hersteller Artikelnummer: CSB-EP864008HU
Alternativnummer: CSB-EP864008HU-1, CSB-EP864008HU-100, CSB-EP864008HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Duranin
Molekulargewicht: 61.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q9H9P8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 52-463aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.