Recombinant Human Interleukin-23 subunit alpha (IL23A), Biotinylated

Artikelnummer: CSB-EP868278HU-B
Artikelname: Recombinant Human Interleukin-23 subunit alpha (IL23A), Biotinylated
Artikelnummer: CSB-EP868278HU-B
Hersteller Artikelnummer: CSB-EP868278HU-B
Alternativnummer: CSB-EP868278HU-B-1, CSB-EP868278HU-B-100, CSB-EP868278HU-B-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-23 subunit p19
Molekulargewicht: 66.4 kDa
Tag: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
UniProt: Q9NPF7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.78.
Quelle: E.coli
Expression System: 20-189aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Anwendungsbeschreibung: Research Areas: Immunology