Recombinant Human Gamma-1-syntrophin (SNTG1)

Artikelnummer: CSB-EP873648HU
Artikelname: Recombinant Human Gamma-1-syntrophin (SNTG1)
Artikelnummer: CSB-EP873648HU
Hersteller Artikelnummer: CSB-EP873648HU
Alternativnummer: CSB-EP873648HU-1, CSB-EP873648HU-100, CSB-EP873648HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Syntrophin-4
Molekulargewicht: 63 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9NSN8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-517aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTIRRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDW
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.