Recombinant Human Protein C1orf43 (C1orf43), partial

Artikelnummer: CSB-EP874824HU1
Artikelname: Recombinant Human Protein C1orf43 (C1orf43), partial
Artikelnummer: CSB-EP874824HU1
Hersteller Artikelnummer: CSB-EP874824HU1
Alternativnummer: CSB-EP874824HU1-1, CSB-EP874824HU1-100, CSB-EP874824HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (Hepatitis C virus NS5A-transactivated protein 4)(HCV NS5A-transactivated protein 4)(Protein NICE-3)(S863-3)
Molekulargewicht: 32.9 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9BWL3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 32-253aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.