Recombinant Arabidopsis thaliana Serpin-ZX

Artikelnummer: CSB-EP886615DOA
Artikelname: Recombinant Arabidopsis thaliana Serpin-ZX
Artikelnummer: CSB-EP886615DOA
Hersteller Artikelnummer: CSB-EP886615DOA
Alternativnummer: CSB-EP886615DOA-1, CSB-EP886615DOA-100, CSB-EP886615DOA-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: ArathZx,AtSerpin1,Serpin-1
Molekulargewicht: 49.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9S7T8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-391aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDVRESISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSFLKFSSTDQLNSFSSEIVSAVLADGSANGGPKLSVANGAWIDKSLSFKPSFKQLLEDSYKAASNQADFQSKAVEVIAEVNSWAEKETNGLITEVLPEGSADSMTKLIFANALYFKGTWNEKFDESLTQEGEFHLLDGNKVTAPFMTSKKKQYVSAYDGFKVLGLPYLQGQDKRQFSMYFYLPDANNGLSDLLDKIV
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.