Recombinant Human Small muscular protein (SMPX)
Artikelnummer:
CSB-EP887043HU
- Bilder (0)
| Artikelname: | Recombinant Human Small muscular protein (SMPX) |
| Artikelnummer: | CSB-EP887043HU |
| Hersteller Artikelnummer: | CSB-EP887043HU |
| Alternativnummer: | CSB-EP887043HU-1, CSB-EP887043HU-100, CSB-EP887043HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Stretch-responsive skeletal muscle protein |
| Molekulargewicht: | 36.6 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | Q9UHP9 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1-88aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ |
Produktgarantie und fachkundiger Support
