Recombinant Human Protein MEMO1 (MEMO1)

Artikelnummer: CSB-EP896500HU
Artikelname: Recombinant Human Protein MEMO1 (MEMO1)
Artikelnummer: CSB-EP896500HU
Hersteller Artikelnummer: CSB-EP896500HU
Alternativnummer: CSB-EP896500HU-1, CSB-EP896500HU-100, CSB-EP896500HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: C21orf19-like protein Hepatitis C virus NS5A-transactivated protein 7
Molekulargewicht: 60.7 kDa
Tag: N-terminal GST-tagged
UniProt: Q9Y316
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-297aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.