Recombinant Human ER membrane protein complex subunit 9 (EMC9)

Artikelnummer: CSB-EP897482HU
Artikelname: Recombinant Human ER membrane protein complex subunit 9 (EMC9)
Artikelnummer: CSB-EP897482HU
Hersteller Artikelnummer: CSB-EP897482HU
Alternativnummer: CSB-EP897482HU-1, CSB-EP897482HU-100, CSB-EP897482HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Protein FAM158A
Molekulargewicht: 39.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q9Y3B6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-208aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.