Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial

Artikelnummer: CSB-EP897502HU
Artikelname: Recombinant Human Protocadherin gamma-B3 (PCDHGB3), partial
Artikelnummer: CSB-EP897502HU
Hersteller Artikelnummer: CSB-EP897502HU
Alternativnummer: CSB-EP897502HU-1, CSB-EP897502HU-100, CSB-EP897502HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: PCDH-gamma-B3
Molekulargewicht: 52.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9Y5G1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 31-444aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EPIRYAIPEELDRGSLVGNLAKDLGFGVGDLPTRNLRVIAEKKFFTVSPENGNLLVSDRIDREEICGKKSTCVLEFEMVAEKPLNFFHVTVLIQDINDNPPTFSQNITELEISELALTGATFALESAQDPDVGVNSLQQYYLSPDPHFSLIQKENLDGSRYPELVLKAPLDREEQPHHHLVLTAVDGGEPSRSCTTQIRVIVADANDNPPVFTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIG
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.